PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0102s0056.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 356aa    MW: 40121.7 Da    PI: 9.4771
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0102s0056.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B351.12.4e-16784687
                         ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                   B3  6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87
                         +++d ++++ l lp++f e++g k ++   ++l+ ++g +W+v++  +k+s++++l++GW +F+++ g+k g f+vF +d  
  Kaladp0102s0056.2.p  7 VTADITTRSKLKLPRRFGERCGAKVPG--NVRLQVPTGATWRVEV--KKNSNGVWLGEGWFKFAESLGVKYGHFLVFDYDAV 84
                         5789999999***********888666..6***************..*******************************9864 PP

2B372.26.5e-23256347699
                          ..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                   B3   6 tpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                          +p  + ++++l +p +f+e++ +  k   k+ tl++ +gr+W+vk++  +++ r ++t+GW +Fv++ngLk+gD+++F+l++  e   +v
  Kaladp0102s0056.2.p 256 SPDGTARECQLLVPMPFIEAYfN-LKI--KDATLRTDDGRKWSVKYRLARYRPRSYFTSGWTQFVRDNGLKAGDVCLFELIRGAENAIKV 342
                          55566788*************53.433..489****************99999999*************************986666899 PP

                          EEE-S CS
                   B3  95 kvfrk 99 
                           +fr+
  Kaladp0102s0056.2.p 343 VIFRA 347
                          88885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.464296IPR003340B3 DNA binding domain
SuperFamilySSF1019361.59E-17293IPR015300DNA-binding pseudobarrel domain
CDDcd100172.01E-16390No hitNo description
SMARTSM010199.3E-13396IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.3E-17395IPR015300DNA-binding pseudobarrel domain
PfamPF023625.8E-14786IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.4E-22235346IPR015300DNA-binding pseudobarrel domain
CDDcd100171.02E-23249346No hitNo description
SMARTSM010192.5E-17251348IPR003340B3 DNA binding domain
PROSITE profilePS5086315.552251348IPR003340B3 DNA binding domain
PfamPF023624.5E-21256347IPR003340B3 DNA binding domain
SuperFamilySSF1019361.04E-20261346IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MKFFRIVTAD ITTRSKLKLP RRFGERCGAK VPGNVRLQVP TGATWRVEVK KNSNGVWLGE  60
GWFKFAESLG VKYGHFLVFD YDAVRAVFHV VAIGMSAVET EYPTVSSIDD DDDQSGRNPR  120
LSNLKRRKIE KDDDDDDDDV VILKDDANLG RSKPQKCQAP GKKAKASKCE VDQSMCGNGS  180
VRSDDGDLTT TKKRGKFERE IILNRERMIQ CIVQGRGRNN RANDQAEKAI ERAKSFKADE  240
PVCIIALSPC YVTRESPDGT ARECQLLVPM PFIEAYFNLK IKDATLRTDD GRKWSVKYRL  300
ARYRPRSYFT SGWTQFVRDN GLKAGDVCLF ELIRGAENAI KVVIFRAISE DEAVK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.19e-26B3 family protein